PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009678P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 302aa    MW: 34007.2 Da    PI: 9.3408
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009678P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-1697142147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia+ +  gR++k+c++rw++ 
   MELO3C009678P1  97 RGHWRPAEDTKLKELVAHYGPQNWNLIAENLH-GRSGKSCRLRWFNQ 142
                      899*****************************.***********996 PP

2Myb_DNA-binding53.94.2e-17149192146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++ +eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
   MELO3C009678P1 149 RKAFNEEEEERLLTAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 192
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.87392143IPR017930Myb domain
SMARTSM007172.0E-1396145IPR001005SANT/Myb domain
SuperFamilySSF466897.35E-2897190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-2698150IPR009057Homeodomain-like
CDDcd001675.68E-12100141No hitNo description
PfamPF139216.8E-16100160No hitNo description
PROSITE profilePS5129425.422144198IPR017930Myb domain
SMARTSM007171.1E-14148196IPR001005SANT/Myb domain
CDDcd001674.28E-11151191No hitNo description
Gene3DG3DSA:1.10.10.604.2E-20151197IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MNLHYSFNHA LQPPTSMLLN NVPFIPPPPP PPLPPTLGDH LPFPTSWEIG KGDARQIHSE  60
EEERDDDNDN DGNVLVTYRN DGPKNSGARR HTKLCARGHW RPAEDTKLKE LVAHYGPQNW  120
NLIAENLHGR SGKSCRLRWF NQLDPKINRK AFNEEEEERL LTAHRLYGNK WAMIARLFPG  180
RTDNAVKNHW HVIMARKHRQ HSNLYRRSTR KPLPPPPPPP PPPPHDPSGL NVDENLDVKG  240
FTKHNVSSES SISSTVDESA ASPSTATHLS LSNSSSLCIA LHPTPSKFIR PNNIIYIPSY  300
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32961976107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443134.10.0PREDICTED: transcription factor MYB44
TrEMBLA0A0A0LEK91e-146A0A0A0LEK9_CUCSA; Uncharacterized protein
STRINGGLYMA03G00980.15e-75(Glycine max)
STRINGGSMUA_Achr9P04990_0015e-75(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.14e-69myb domain protein 105